Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-CD22 Polyclonal Antibody

  • PTX19612-50
  • Validated WB
Clonality:
Polyclonal Antibody

Original price was: $193.00.Current price is: $140.00.

50ug 27% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-CD22 Polyclonal Antibody binds to Human CD22 recombinant protein in WB Assay

Anti-CD22 Polyclonal Antibody

Product name PTX19612-100
Uniprot ID P20273
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Aliases /Synonyms Anti-CD22, Anti-Siglec-2, Anti-BL-CAM
Clonality Polyclonal Antibody
Product name PTX19612-1MG
Uniprot ID P20273
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Aliases /Synonyms Anti-CD22, Anti-Siglec-2, Anti-BL-CAM
Clonality Polyclonal Antibody
Product name PTX19612-50
Uniprot ID P20273
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Aliases /Synonyms Anti-CD22, Anti-Siglec-2, Anti-BL-CAM
Clonality Polyclonal Antibody

Anti-CD22 Polyclonal Antibody binds to Human CD22 recombinant protein in WB Assay

Anti-CD22 Polyclonal Antibody binds to Human CD22 recombinant protein in WB Assay

Human CD22 recombinant protein(cat. No.PX-P6369) can bind Anti-CD22 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-CD22 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products