Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036)

  • ARO-A16306
  • Validated ELISA
Note:
For research use only. Not suitable for human use.

$452.00

100ug + 452 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036)

Product name Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036)
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human respiratory syncytial virus A (strain A2)
Aliases /Synonyms anti-Fusion glycoprotein F0, anti-Fusion glycoprotein F2, anti-F2, anti-p27, anti-Intervening segment, anti-Pep27, anti-Peptide 27, anti-Fusion glycoprotein F1, anti-F1, anti-F, anti-Human respiratory syncytial virus A (strain A2)
Reference ARO-A16306
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen F/Fusion glycoprotein F0
Clone Name SAA1036
Target species Anti-Human respiratory syncytial virus A (strain A2) Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036) binds to HRSV Fusion glycoprotein, N-His in ELISA Assay

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036) binds to HRSV Fusion glycoprotein, N-His in ELISA Assay

HRSV Fusion glycoprotein, N-His(cat. No.ARO-P18673) at 0.5µg/mL (100µL/well) can bind Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036) in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036)

SDS-PAGE for Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036)

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036)

There are no reviews yet.

Be the first to review “Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1036)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products