Brand: ProteoGenix

Anti-Human C1q Monoclonal Antibody (ANX005)

PTX26573-100
Quality Chart

Clonality:: Monoclonal Antibody
Isotype:: IgG

Original price was: $546.00.Current price is: $451.00.

100ug 17% OFF + 451 loyalty points

Size Size

50ug Original price was: $411.00.Current price is: $315.00.
100ug Original price was: $546.00.Current price is: $451.00.
1MG Original price was: $1,714.00.Current price is: $1,308.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human C1q Monoclonal Antibody (ANX005)

Product name	PTX26573-100
Uniprot ID	P02745
Raw Antigen Sequence	MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-C1QA, ANX005, ANX 005, ANX-005
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	C1QA

Product name	PTX26573-1MG
Uniprot ID	P02745
Raw Antigen Sequence	MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-C1QA, ANX005, ANX 005, ANX-005
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	C1QA

Product name	PTX26573-50
Uniprot ID	P02745
Raw Antigen Sequence	MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-C1QA, ANX005, ANX 005, ANX-005
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	C1QA

Datasheet

SDS-PAGE for Anti-Human C1q Monoclonal Antibody (ANX005)

Anti-Human C1q Monoclonal Antibody (ANX005), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human C1q Monoclonal Antibody (ANX005)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human C1q Monoclonal Antibody (ANX005)

Anti-Human C1q Monoclonal Antibody (ANX005)

SDS-PAGE for Anti-Human C1q Monoclonal Antibody (ANX005)

Related products

Anti-Human C1q Complement Polyclonal Antibody, FITC

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human C1q Monoclonal Antibody (ANX005)

Specifications Anti-Human C1q Monoclonal Antibody (ANX005)

Documents

QC & Validation

SDS-PAGE for Anti-Human C1q Monoclonal Antibody (ANX005)

Reviews

Related products

Anti-Human C1q Complement Polyclonal Antibody, FITC

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human C1q Monoclonal Antibody (ANX005)