Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD275/ICOSLG Antibody (SAA0089), PE

  • ARO-A10725-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Human
Isotype:
IgG2, kappa
Clone Name:
SAA0089

Original price was: $518.00.Current price is: $421.00.

50ug 19% OFF + 421 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD275/ICOSLG Antibody (SAA0089), PE

Product name ARO-A10725-100
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10725
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089
Product name ARO-A10725-1MG
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10725
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089
Product name ARO-A10725-50
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10725
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089

Flow Cytometry results for Anti-Human CD275/ICOSLG Antibody (SAA0089), PE

Flow Cytometry results for Anti-Human CD275/ICOSLG Antibody (SAA0089), PE

Flow-cytometry using PE anti-human CD275 antibody. U937 cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD275 monoclonal antibody (Catalog: ARO-A10725, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD275/ICOSLG Antibody (SAA0089), PE”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products