Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human FGF19 Antibody (SAA1435)

  • ARO-A15374-100
  • Validated ELISA FC WB

Original price was: $488.00.Current price is: $407.00.

100ug 17% OFF + 407 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human FGF19 Antibody (SAA1435) binds to Recombinant Human FGF19, N-His in WB Assay
Flow Cytometry results for Anti-Human FGF19 Antibody (SAA1435)
Anti-Human FGF19 Antibody (SAA1435)

Anti-Human FGF19 Antibody (SAA1435)

Product name ARO-A15374-100
Uniprot ID O95750
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Reference ARO-A15374
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen FGF19,Fibroblast growth factor 19,FGF-19
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15374-1MG
Uniprot ID O95750
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Reference ARO-A15374
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen FGF19,Fibroblast growth factor 19,FGF-19
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15374-50
Uniprot ID O95750
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Reference ARO-A15374
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen FGF19,Fibroblast growth factor 19,FGF-19
Target species Anti-Human Monoclonal Antibody

Anti-Human FGF19 Antibody (SAA1435) binds to Recombinant Human FGF19, N-His in WB Assay

Anti-Human FGF19 Antibody (SAA1435) binds to Recombinant Human FGF19, N-His in WB Assay

Recombinant Human FGF19, N-His(cat. No.ARO-P14225) can bind Anti-Human FGF19 Antibody (SAA1435) in Western Blot Assay as detected on gel analysis.

Flow Cytometry results for Anti-Human FGF19 Antibody (SAA1435)

Flow Cytometry results for Anti-Human FGF19 Antibody (SAA1435)

Target Cells were stained with an irrelevant antibody or Anti-Human FGF19 Antibody (SAA1435) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human FGF19 Antibody (SAA1435)

There are no reviews yet.

Be the first to review “Anti-Human FGF19 Antibody (SAA1435)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products