Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human IL11 Monoclonal Antibody (X203)

  • PTX25416-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Human
Isotype:
IgG1, kappa

Original price was: $403.00.Current price is: $315.00.

50ug 22% OFF + 315 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human IL11 Monoclonal Antibody (X203)

Product name PTX25416-100
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL11, Anti-IL-11, Anti-AGIF, EnX203, EnX 203, EnX-203, X203
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL11
Product name PTX25416-1MG
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL11, Anti-IL-11, Anti-AGIF, EnX203, EnX 203, EnX-203, X203
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL11
Product name PTX25416-50
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL11, Anti-IL-11, Anti-AGIF, EnX203, EnX 203, EnX-203, X203
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL11

Anti-Human IL11 Monoclonal Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in WB Assay

Anti-Human IL11 Monoclonal Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in WB Assay

Human IL11 Recombinant Protein, N-GST & C-His(cat. No.ARO-P18107) can bind Anti-Human IL11 Monoclonal Antibody (X203) in Western Blot Assay as detected on gel analysis.

Anti-Human IL11 Monoclonal Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in ELISA Assay

Anti-Human IL11 Monoclonal Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in ELISA Assay

Human IL11 Recombinant Protein, N-GST & C-His(cat. No.ARO-P18107) at 0.5µg/mL (100µL/well) can bind Anti-Human IL11 Monoclonal Antibody (X203) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Anti-Human IL11 Monoclonal Antibody (X203)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products