Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

  • ARO-A15407-100
  • Validated ELISA

Original price was: $572.00.Current price is: $462.00.

100ug 19% OFF + 462 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human/Mouse/Rat MOG Antibody (8-18C5)
SDS-PAGE for Anti-Human/Mouse/Rat MOG Antibody (8-18C5)
Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Product name ARO-A15407-100
Uniprot ID Q63345
Raw Antigen Sequence MAGVWSLSLPSCLLSLLLLLQLSRSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGVLALIALVPMLLLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rat, Bovine
Reference ARO-A15407
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen MOG
Clone Name 8-18C5
Protein Name MOG
Target species Anti-Human, Mouse, Rat, Bovine Monoclonal Antibody
Product name ARO-A15407-1MG
Uniprot ID Q63345
Raw Antigen Sequence MAGVWSLSLPSCLLSLLLLLQLSRSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGVLALIALVPMLLLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rat, Bovine
Reference ARO-A15407
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen MOG
Clone Name 8-18C5
Protein Name MOG
Target species Anti-Human, Mouse, Rat, Bovine Monoclonal Antibody
Product name ARO-A15407-50
Uniprot ID Q63345
Raw Antigen Sequence MAGVWSLSLPSCLLSLLLLLQLSRSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGVLALIALVPMLLLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rat, Bovine
Reference ARO-A15407
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen MOG
Clone Name 8-18C5
Protein Name MOG
Target species Anti-Human, Mouse, Rat, Bovine Monoclonal Antibody

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Anti-Human/Mouse/Rat MOG Antibody (8-18C5) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

SDS-PAGE for Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Anti-Human/Mouse/Rat MOG Antibody (8-18C5), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

There are no reviews yet.

Be the first to review “Anti-Human/Mouse/Rat MOG Antibody (8-18C5)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products