Brand: ProteoGenix

Anti-Mexican scorpion Toxin 2 Antibody (9004G)

ARO-A17422-50
Quality Chart

Clonality:: Monoclonal Antibody
Isotype:: IgG1, kappa

Original price was: $426.00.Current price is: $315.00.

50ug 26% OFF + 315 loyalty points

Size Size

50ug Original price was: $426.00.Current price is: $315.00.
100ug Original price was: $632.00.Current price is: $451.00.
1MG Original price was: $1,583.00.Current price is: $1,308.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Mexican scorpion Toxin 2 Antibody (9004G)

Product name	ARO-A17422-100
Uniprot ID	P01495
Raw Antigen Sequence	LLIITACLALIGTVWAKEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCSGK
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-Toxin 2
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Protein Name	Toxin 2

Product name	ARO-A17422-1MG
Uniprot ID	P01495
Raw Antigen Sequence	LLIITACLALIGTVWAKEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCSGK
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-Toxin 2
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Protein Name	Toxin 2

Product name	ARO-A17422-50
Uniprot ID	P01495
Raw Antigen Sequence	LLIITACLALIGTVWAKEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCSGK
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-Toxin 2
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Protein Name	Toxin 2

Datasheet

SDS-PAGE for Anti-Mexican scorpion Toxin 2 Antibody (9004G)

Anti-Mexican scorpion Toxin 2 Antibody (9004G), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Mexican scorpion Toxin 2 Antibody (9004G)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Mexican scorpion Toxin 2 Antibody (9004G)

Anti-Mexican scorpion Toxin 2 Antibody (9004G)

SDS-PAGE for Anti-Mexican scorpion Toxin 2 Antibody (9004G)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Mexican scorpion Toxin 2 Antibody (9004G)

Specifications Anti-Mexican scorpion Toxin 2 Antibody (9004G)

Documents

QC & Validation

SDS-PAGE for Anti-Mexican scorpion Toxin 2 Antibody (9004G)

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Mexican scorpion Toxin 2 Antibody (9004G)