Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse CD152/CTLA4 Antibody (H11)

  • ARO-A15655-100
  • Validated ELISA FC

Original price was: $609.00.Current price is: $462.00.

100ug 24% OFF + 462 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Mouse CD152/CTLA4 Antibody (H11) binds to Mouse CD152 recombinant protein in ELISA Assay
Flow Cytometry results for Anti-Mouse CD152/CTLA4 Antibody (H11)
Anti-Mouse CD152/CTLA4 Antibody (H11)

Anti-Mouse CD152/CTLA4 Antibody (H11)

Product name ARO-A15655-100
Uniprot ID P09793
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15655
Isotype VHH-mFc
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4
Clone Name H11
Protein Name CD152/CTLA4
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15655-1MG
Uniprot ID P09793
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15655
Isotype VHH-mFc
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4
Clone Name H11
Protein Name CD152/CTLA4
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15655-50
Uniprot ID P09793
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15655
Isotype VHH-mFc
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4
Clone Name H11
Protein Name CD152/CTLA4
Target species Anti-Mouse Monoclonal Antibody

Anti-Mouse CD152/CTLA4 Antibody (H11) binds to Mouse CD152 recombinant protein in ELISA Assay

Anti-Mouse CD152/CTLA4 Antibody (H11) binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Anti-Mouse CD152/CTLA4 Antibody (H11) in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Anti-Mouse CD152/CTLA4 Antibody (H11)

Flow Cytometry results for Anti-Mouse CD152/CTLA4 Antibody (H11)

Target Cells were stained with an irrelevant antibody or Anti-Mouse CD152/CTLA4 Antibody (H11) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Mouse CD152/CTLA4 Antibody (H11)

There are no reviews yet.

Be the first to review “Anti-Mouse CD152/CTLA4 Antibody (H11)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products