Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse CD257/BAFF/TNFSF13B/BLYS Polyclonal Antibody

  • ARO-A12786-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $181.00.Current price is: $140.00.

50ug 23% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Mouse CD257/BAFF/TNFSF13B/BLYS Polyclonal Antibody binds to CD257 Recombinant Protein in WB Assay

Anti-Mouse CD257/BAFF/TNFSF13B/BLYS Polyclonal Antibody

Product name ARO-A12786-100
Uniprot ID Q9WU72
Raw Antigen Sequence AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-BAFF, ZTNF4, BLYS, Tumor necrosis factor ligand superfamily member 13B, Dendritic cell-derived TNF-like molecule, TALL-1, TNF- and APOL-related leukocyte expressed ligand 1, BLyS, B lymphocyte stimulator, TNFSF13B, CD257, TNFSF20, TALL1, B-cell-activating factor, Drug Target
Reference ARO-A12786
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse CD257/BAFF/TNFSF13B/BLYS (Ala127-Leu309).
Product name ARO-A12786-1MG
Uniprot ID Q9WU72
Raw Antigen Sequence AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-BAFF, ZTNF4, BLYS, Tumor necrosis factor ligand superfamily member 13B, Dendritic cell-derived TNF-like molecule, TALL-1, TNF- and APOL-related leukocyte expressed ligand 1, BLyS, B lymphocyte stimulator, TNFSF13B, CD257, TNFSF20, TALL1, B-cell-activating factor, Drug Target
Reference ARO-A12786
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse CD257/BAFF/TNFSF13B/BLYS (Ala127-Leu309).
Product name ARO-A12786-50
Uniprot ID Q9WU72
Raw Antigen Sequence AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-BAFF, ZTNF4, BLYS, Tumor necrosis factor ligand superfamily member 13B, Dendritic cell-derived TNF-like molecule, TALL-1, TNF- and APOL-related leukocyte expressed ligand 1, BLyS, B lymphocyte stimulator, TNFSF13B, CD257, TNFSF20, TALL1, B-cell-activating factor, Drug Target
Reference ARO-A12786
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse CD257/BAFF/TNFSF13B/BLYS (Ala127-Leu309).

Anti-Mouse CD257/BAFF/TNFSF13B/BLYS Polyclonal Antibody binds to CD257 Recombinant Protein in WB Assay

Anti-Mouse CD257/BAFF/TNFSF13B/BLYS Polyclonal Antibody binds to CD257 Recombinant Protein in WB Assay

CD257 Recombinant Protein(cat. No.PX-P4112) can bind Anti-Mouse CD257/BAFF/TNFSF13B/BLYS Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Mouse CD257/BAFF/TNFSF13B/BLYS Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products