Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

Note:
For research use only. Not suitable for human use.

Original price was: $412.00.Current price is: $317.00.

50ug 23% OFF + 317 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

Product name ARO-A16257-100
Uniprot ID P01556
Raw Antigen Sequence MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Cholera enterotoxin subunit B, anti-Cholera enterotoxin B chain, anti-Cholera enterotoxin gamma chain, anti-Choleragenoid, anti-ctxB, anti-toxB, anti-VC_1456
Reference ARO-A16257
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen ctxB/Cholera Toxin Subunit B
Clone Name SAA1345
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody
Product name ARO-A16257-1MG
Uniprot ID P01556
Raw Antigen Sequence MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Cholera enterotoxin subunit B, anti-Cholera enterotoxin B chain, anti-Cholera enterotoxin gamma chain, anti-Choleragenoid, anti-ctxB, anti-toxB, anti-VC_1456
Reference ARO-A16257
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen ctxB/Cholera Toxin Subunit B
Clone Name SAA1345
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody
Product name ARO-A16257-50
Uniprot ID P01556
Raw Antigen Sequence MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Cholera enterotoxin subunit B, anti-Cholera enterotoxin B chain, anti-Cholera enterotoxin gamma chain, anti-Choleragenoid, anti-ctxB, anti-toxB, anti-VC_1456
Reference ARO-A16257
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen ctxB/Cholera Toxin Subunit B
Clone Name SAA1345
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

SDS-PAGE for Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

There are no reviews yet.

Be the first to review “Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products