Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Avizakimab Biosimilar – Anti-IL21 mAb – Research Grade

  • PX-TA1579-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade

Product name Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade
Uniprot ID Q9HBE4
Source CAS 2229685-51-0
Species Humanized
Raw Antigen Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Avizakimab ,BOS161721,IL21,anti-IL21
Reference PX-TA1579
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade
Uniprot ID Q9HBE4
Source CAS 2229685-51-0
Species Humanized
Raw Antigen Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Avizakimab ,BOS161721,IL21,anti-IL21
Reference PX-TA1579
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1579-50
Uniprot ID Q9HBE4
Source CAS 2229685-51-0
Species Humanized
Raw Antigen Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Avizakimab ,BOS161721,IL21,anti-IL21
Reference PX-TA1579
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Avizakimab Biosimilar – Anti-IL21 mAb

Avizakimab Biosimilar, also known as Anti-IL21 monoclonal antibody (mAb), is a novel therapeutic agent that has recently gained attention in the field of immunology. It is a biosimilar version of the original Avizakimab, which is an FDA-approved drug for the treatment of certain autoimmune diseases. Avizakimab Biosimilar is a potent antibody that specifically targets interleukin 21 (IL-21), a cytokine involved in the regulation of immune responses. In this article, we will discuss the structure, activity, and potential applications of Avizakimab Biosimilar in research.

Structure of Avizakimab Biosimilar

Avizakimab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced in the laboratory using genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have two constant domains (CL1 and CL2) and one variable domain (VL). The variable domains of both heavy and light chains are responsible for the specificity of Avizakimab Biosimilar to IL-21.

Mechanism of Action

Avizakimab Biosimilar exerts its therapeutic effects by binding to IL-21 with high affinity and preventing its interaction with its receptor. IL-21 is a pro-inflammatory cytokine produced by activated T cells and is involved in the activation and differentiation of various immune cells, including B cells, T cells, and natural killer cells. By blocking the IL-21 signaling pathway, Avizakimab Biosimilar inhibits the production of inflammatory mediators and reduces the activity of immune cells, leading to a decrease in the inflammatory response.

Applications in Research

Avizakimab Biosimilar has shown promising results in preclinical studies as a potential treatment for autoimmune diseases, such as rheumatoid arthritis, psoriasis, and lupus. In addition, it has also been investigated as a therapy for various inflammatory conditions, including inflammatory bowel disease and multiple sclerosis. Its ability to specifically target IL-21 makes it a potential candidate for the treatment of diseases where IL-21 plays a crucial role in the pathogenesis.

Moreover, Avizakimab Biosimilar has also been used in research to study the role of IL-21 in different disease models. For example, in a study on psoriasis, Avizakimab Biosimilar was used to block IL-21 and investigate its role in the development of psoriatic lesions. This study showed that IL-21 is essential for the maintenance of psoriatic inflammation and that targeting IL-21 with Avizakimab Biosimilar could be a potential therapeutic strategy for psoriasis.

Future Directions

Avizakimab Biosimilar is currently in the preclinical stage of development, and further studies are needed to establish its safety and efficacy in humans. If successful, it has the potential to become a valuable therapeutic option for various autoimmune and inflammatory diseases. Additionally, as IL-21 has been implicated in the development of certain types of cancer, Avizakimab Biosimilar could also be investigated as a potential anti- cancer therapy in the future.

Conclusion

In summary, Avizakimab Biosimilar is a promising biosimilar version of the FDA-approved drug, Avizakimab. It is a potent anti-IL21 monoclonal antibody with a specific binding affinity for IL-21. Its mechanism of action involves blocking the IL-21 signaling pathway, leading to a decrease in inflammatory responses. Avizakimab Biosimilar has potential applications in the treatment of autoimmune and inflammatory diseases and has also been used in research to study the role of IL-21 in various disease models. Further studies are needed

SDS-PAGE for Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade

SDS-PAGE for Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade

Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade binds to Recombinant Mouse IL21 Protein, N-His in ELISA Assay

Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade binds to Recombinant Mouse IL21 Protein, N-His in ELISA Assay

Recombinant Mouse IL21 Protein, N-His(cat. No.ARO-P12734) at 0.5µg/mL (100µL/well) can bind Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Avizakimab  Biosimilar - Anti-IL21 mAb - Research Grade

There are no reviews yet.

Be the first to review “Avizakimab Biosimilar – Anti-IL21 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products