Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb – Research Grade

  • PX-TA2109-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $217.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Bezetabart Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade

Product name PX-TA2109-50
Uniprot ID P04233
Source CAS: 2763746-69-4
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2109
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Bezetabart Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade
Uniprot ID P04233
Source CAS: 2763746-69-4
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2109
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Bezetabart Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade
Uniprot ID P04233
Source CAS: 2763746-69-4
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2109
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Bezetabart Biosimilar, also known as Anti-HLA-DR antigens-associated invariant chain monoclonal antibody (mAb), is a research grade antibody that has shown promising results in the field of immunology. This article will provide a detailed description of the structure, activity and potential applications of this biosimilar.

Structure of Bezetabart Biosimilar

Bezetabart Biosimilar is a monoclonal antibody that specifically targets the human leukocyte antigen (HLA)-DR antigens-associated invariant chain (Ii). It is a recombinant antibody, produced by cloning and expressing the gene for the antibody in a host cell. The antibody is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to the target antigen, while the constant regions provide stability to the antibody.

Activity of Bezetabart Biosimilar

Bezetabart Biosimilar has been designed to target the HLA-DR antigens-associated Ii, which is a protein involved in the process of antigen presentation. This protein is present on the surface of antigen-presenting cells, such as dendritic cells, macrophages and B cells. Bezetabart Biosimilar binds to the Ii protein and blocks its interaction with the HLA-DR antigens, thereby inhibiting the presentation of antigens to T cells.

This activity of Bezetabart Biosimilar has been demonstrated in various in vitro and in vivo studies. In one study, the biosimilar was shown to effectively inhibit the presentation of a model antigen by dendritic cells, leading to a decrease in T cell activation. In another study, it was found to reduce the production of pro-inflammatory cytokines by macrophages, suggesting its potential as an anti-inflammatory agent.

Potential Applications of Bezetabart Biosimilar

The unique mechanism of action of Bezetabart Biosimilar makes it a promising therapeutic target for various diseases and conditions. Some potential applications of this biosimilar are discussed below.

1. Autoimmune Diseases Autoimmune diseases are characterized by an overactive immune system that attacks the body’s own tissues. The role of HLA-DR antigens and Ii in autoimmune diseases has been well-established. Therefore, Bezetabart Biosimilar could be used as a novel treatment for these conditions by targeting the HLA-DR antigens-associated Ii and reducing the activation of T cells.

2.

Transplant Rejection

Organ transplantation is a common treatment for end-stage organ failure. However, transplant rejection, which occurs when the recipient’s immune system recognizes the transplanted organ as foreign and attacks it, remains a major challenge. Bezetabart Biosimilar could potentially prevent transplant rejection by inhibiting the presentation of donor antigens to T cells, thereby reducing the risk of immune-mediated rejection.

3.

Cancer

The immune system plays a crucial role in detecting and eliminating cancer cells. However, cancer cells can evade the immune system by downregulating the expression of HLA-DR antigens. Bezetabart Biosimilar could potentially overcome this immune evasion by targeting the Ii protein, which is involved in the expression of HLA-DR antigens. This could enhance the immune response against cancer cells and improve the efficacy of cancer treatments.

4.

Infectious Diseases

Bezetabart Biosimilar could also be used in the treatment of infectious diseases, as the HLA-DR antigens and Ii are involved in the presentation of antigens from infectious agents to T cells. By inhibiting this process, the biosimilar could potentially reduce the severity of infections and improve the efficacy of existing treatments.

Conclusion

In conclusion, Bezetabart Biosimilar is a research grade antibody that targets the HLA-DR antigens-associated Ii and has shown promising results in various studies. Its unique mechanism of action makes it a potential therapeutic target for autoimmune diseases, transplant rejection, cancer and infectious diseases. Further research and clinical trials are needed to fully explore the potential of this biosimilar in the field of immunology.

Research Grade Bezetabart in ELISA Assay

Research Grade Bezetabart in ELISA Assay

Research Grade Bezetabart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Bezetabart

SDS-PAGE for Research Grade Bezetabart

Research Grade Bezetabart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bezetabart Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade

There are no reviews yet.

Be the first to review “Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products