Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Navenibart Biosimilar – Anti-Plasma prekallikrein mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Navenibart Biosimilar - Anti-Plasma prekallikrein mAb - Research Grade

Product name PX-TA2203-50
Uniprot ID P03952
Source CAS: 2803430-16-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Plasma prekallikrein, KLK3, Fletcher factor, KLKB1, Kininogenin, Plasma kallikrein, PKK
Reference PX-TA2203-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Navenibart Biosimilar - Anti-Plasma prekallikrein mAb - Research Grade
Uniprot ID P03952
Source CAS: 2803430-16-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Plasma prekallikrein, KLK3, Fletcher factor, KLKB1, Kininogenin, Plasma kallikrein, PKK
Reference PX-TA2203-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Navenibart Biosimilar - Anti-Plasma prekallikrein mAb - Research Grade
Uniprot ID P03952
Source CAS: 2803430-16-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Plasma prekallikrein, KLK3, Fletcher factor, KLKB1, Kininogenin, Plasma kallikrein, PKK
Reference PX-TA2203-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Navenibart Biosimilar – Anti-Plasma prekallikrein mAb – Research Grade: A Promising Therapeutic Antibody Targeting Plasma Prekallikrein

Introduction
Navenibart Biosimilar – Anti-Plasma prekallikrein mAb – Research Grade is a novel therapeutic antibody that has shown promising results in targeting plasma prekallikrein, a key component of the coagulation cascade. This biosimilar is a highly specific and potent antibody that has the potential to revolutionize the treatment of various diseases, such as hemophilia, thrombosis, and inflammatory disorders. In this article, we will delve into the structure, activity, and potential applications of this innovative biosimilar in the field of therapeutic antibody research.

Structure of Navenibart Biosimilar
Navenibart Biosimilar is a monoclonal antibody (mAb) that is produced using recombinant DNA technology. It is a biosimilar of the original anti-plasma prekallikrein mAb, which has been extensively studied and demonstrated to be effective in targeting plasma prekallikrein. The structure of this biosimilar is similar to that of the original mAb, with slight modifications to ensure its safety and efficacy. It consists of two identical heavy chains and two identical light chains, which are held together by disulfide bonds. The variable regions of the heavy and light chains are responsible for the antibody’s specificity and binding to its target, plasma prekallikrein.

Activity of Navenibart Biosimilar
Navenibart Biosimilar exerts its therapeutic effects by selectively binding to plasma prekallikrein and inhibiting its activity. Plasma prekallikrein is a serine protease that plays a crucial role in the coagulation cascade. It is activated by factor XIIa and subsequently activates factor XI, leading to the formation of a blood clot. Inhibition of plasma prekallikrein by Navenibart Biosimilar prevents the activation of the coagulation cascade, thereby preventing the formation of blood clots. This mechanism of action makes Navenibart Biosimilar a potential treatment option for conditions characterized by excessive blood clotting, such as thrombosis and hemophilia.

Potential Applications of Navenibart Biosimilar
Navenibart Biosimilar has shown promising results in preclinical studies and has the potential to be used in various therapeutic applications. Its primary indication is in the treatment of hemophilia, a genetic disorder characterized by a deficiency in clotting factors. Navenibart Biosimilar can be used to prevent and treat bleeding episodes in patients with hemophilia by inhibiting the activation of the coagulation cascade. It can also be used as a prophylactic treatment to prevent the development of joint damage in hemophilia patients.

In addition to hemophilia, Navenibart Biosimilar also has potential applications in the treatment of thrombosis, a condition characterized by the formation of blood clots in blood vessels. By inhibiting plasma prekallikrein, Navenibart Biosimilar can prevent the formation of blood clots and reduce the risk of thrombotic events, such as heart attacks and strokes.

Furthermore, Navenibart Biosimilar has shown promising results in the treatment of inflammatory disorders, such as rheumatoid arthritis and inflammatory bowel disease. Plasma prekallikrein has been implicated in the inflammatory response, and inhibiting its activity with Navenibart Biosimilar can potentially reduce inflammation and improve symptoms in these conditions.

Conclusion
In conclusion, Navenibart Biosimilar – Anti-Plasma prekallikrein mAb – Research Grade is a highly specific and potent therapeutic antibody targeting plasma prekallikrein. Its unique structure and mechanism of action make it a promising treatment option for various diseases, including hemophilia, thrombosis, and inflammatory disorders. Further clinical studies are needed to fully evaluate the safety and efficacy of this biosimilar, but it has the potential to significantly improve patient outcomes and revolutionize the field of therapeutic antibody research.

SDS-PAGE for Navenibart Biosimilar - Research Grade

SDS-PAGE for Navenibart Biosimilar - Research Grade

Navenibart Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Navenibart Biosimilar – Anti-Plasma prekallikrein mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products