Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Negalstobart Biosimilar – Anti-FDC mAb – Research Grade

  • PX-TA2128-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Negalstobart Biosimilar - Anti-FDC mAb - Research Grade

Product name PX-TA2128-50
Uniprot ID P18627
Source CAS: 2360418-68-2
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2128
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Negalstobart Biosimilar - Anti-FDC mAb - Research Grade
Uniprot ID P18627
Source CAS: 2360418-68-2
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2128
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Negalstobart Biosimilar - Anti-FDC mAb - Research Grade
Uniprot ID P18627
Source CAS: 2360418-68-2
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2128
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction to Negalstobart Biosimilar – Anti-FDC mAb

Negalstobart Biosimilar – Anti-FDC mAb is a promising research grade antibody that has gained attention in the scientific community for its potential therapeutic applications. In this article, we will explore the structure, activity, and potential applications of this antibody in detail.

Structure of Negalstobart Biosimilar – Anti-FDC mAb

Negalstobart Biosimilar – Anti-FDC mAb is a monoclonal antibody (mAb) that specifically targets follicular dendritic cells (FDCs). FDCs are a type of immune cell found in the lymphoid tissues, such as lymph nodes and spleen. The antibody is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy chains consist of variable and constant regions, while the light chains have only variable regions. This unique structure allows the antibody to bind specifically to FDCs.

Mechanism of Action of Negalstobart Biosimilar – Anti-FDC mAb

The primary mechanism of action of Negalstobart Biosimilar – Anti-FDC mAb is its ability to bind to FDCs and modulate their function. FDCs play a crucial role in the immune response by presenting antigens to B cells and promoting their activation and differentiation. However, in certain diseases, such as autoimmune disorders and cancer, FDCs can become overactive and contribute to disease progression. Negalstobart Biosimilar – Anti-FDC mAb works by inhibiting the function of FDCs, thereby reducing the immune response and potentially treating these diseases.

Title: Potential Applications of Negalstobart Biosimilar – Anti-FDC mAb

Negalstobart Biosimilar – Anti-FDC mAb has shown promising results in preclinical studies for various diseases, including autoimmune disorders and cancer. In autoimmune disorders, the antibody has been shown to reduce the production of autoantibodies and suppress the immune response. This could potentially be beneficial in diseases such as rheumatoid arthritis, lupus, and multiple sclerosis. In cancer, FDCs play a role in promoting tumor growth and metastasis. By targeting FDCs, Negalstobart Biosimilar – Anti-FDC mAb could potentially inhibit tumor growth and metastasis, making it a promising therapeutic option for cancer treatment.

Advantages of Negalstobart Biosimilar – Anti-FDC mAb

One of the main advantages of Negalstobart Biosimilar – Anti-FDC mAb is its specificity for FDCs. This allows for targeted therapy, minimizing potential side effects on other cells and tissues. Additionally, as a biosimilar, it has been shown to have similar efficacy and safety profiles as the original antibody, making it a cost-effective option for patients. Furthermore, the antibody has a long half-life, allowing for less frequent dosing, which can improve patient compliance.

Conclusion

In conclusion, Negalstobart Biosimilar – Anti-FDC mAb is a promising research grade antibody with a unique structure and mechanism of action. Its specificity for FDCs and potential applications in autoimmune disorders and cancer make it a valuable tool for researchers and clinicians. With its advantages of specificity, biosimilarity, and long half-life, this antibody has the potential to be an effective and cost-efficient therapeutic option for various diseases. Further studies and clinical trials are needed to fully explore the potential of Negalstobart Biosimilar – Anti-FDC mAb in treating these diseases.

Research Grade Negalstobart in ELISA Assay

Research Grade Negalstobart in ELISA Assay

Research Grade Negalstobart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Negalstobart

SDS-PAGE for Research Grade Negalstobart

Research Grade Negalstobart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Negalstobart Biosimilar - Anti-FDC mAb - Research Grade

There are no reviews yet.

Be the first to review “Negalstobart Biosimilar – Anti-FDC mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products