Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nezastomig Biosimilar – Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $203.00.Current price is: $167.00.

50ug 18% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Nezastomig Biosimilar - Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb - Research Grade

Product name PX-TA2129-50
Uniprot ID Q04609 & P10747
Source CAS: 2657613-60-8
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2129
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Nezastomig Biosimilar - Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb - Research Grade
Uniprot ID Q04609 & P10747
Source CAS: 2657613-60-8
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2129
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Nezastomig Biosimilar - Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb - Research Grade
Uniprot ID Q04609 & P10747
Source CAS: 2657613-60-8
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2129
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb – Research Grade is a novel biosimilar antibody that targets the T-cell-specific surface glycoprotein CD28. This antibody is designed to mimic the activity of the original antibody, providing a cost-effective and accessible option for researchers and clinicians. In this article, we will discuss the structure, activity, and potential applications of this biosimilar antibody.

Structure

Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb – Research Grade is a monoclonal antibody (mAb) that is produced by recombinant DNA technology. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region is responsible for binding to the target antigen, while the constant region determines the antibody’s effector functions.

Activity

The primary target of Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb – Research Grade is the T-cell-specific surface glycoprotein CD28. This protein is a co-stimulatory molecule that is expressed on the surface of T cells. It plays a crucial role in T cell activation and proliferation, making it an attractive therapeutic target for various diseases.

Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb – Research Grade binds to CD28 with high specificity and affinity, mimicking the activity of the original antibody. This binding leads to the activation of T cells, promoting their proliferation and production of cytokines. This activity can be beneficial in diseases where T cell dysfunction or dysregulation is involved, such as autoimmune diseases and cancer.

Applications

Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb – Research Grade has potential applications in both research and clinical settings. In research, this antibody can be used to study the role of CD28 in T cell function and its involvement in various diseases. It can also be used as a tool to manipulate T cell activity and study its effects on the immune response.

In the clinical setting, Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb – Research Grade has potential as a therapeutic option for diseases where CD28 is dysregulated. This includes autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis, where T cells play a significant role in the pathogenesis. By targeting CD28, this biosimilar antibody can modulate T cell activity and potentially alleviate symptoms in these diseases.

In addition, Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb – Research Grade can also be used in cancer immunotherapy. CD28 is known to be upregulated on tumor-infiltrating T cells, and its activation can promote anti-tumor immune responses. By targeting CD28, this antibody can enhance T cell-mediated killing of cancer cells and potentially improve the efficacy of cancer treatments.

Conclusion

In summary, Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb – Research Grade is a novel biosimilar antibody that targets the T-cell-specific surface glycoprotein CD28. It has a similar structure and activity to the original antibody and has potential applications in both research and clinical settings. By targeting CD28, this biosimilar antibody can modulate T cell activity and potentially be used as a therapeutic option for diseases where CD28 is dysregulated. Further studies and clinical trials are needed to fully understand the potential of this biosimilar antibody in various diseases.

SDS-PAGE for Research Grade Nezastomig

SDS-PAGE for Research Grade Nezastomig

Research Grade Nezastomig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Nezastomig Biosimilar - Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb - Research Grade

There are no reviews yet.

Be the first to review “Nezastomig Biosimilar – Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products