Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA2117-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $213.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Evalstotug Biosimilar - Anti-CD152 mAb - Research Grade

Product name PX-TA2117-50
Uniprot ID P16410
Source CAS: 2460399-39-5
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2117
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Evalstotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2460399-39-5
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2117
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Evalstotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2460399-39-5
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2117
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Evalstotug Biosimilar is a research grade monoclonal antibody (mAb) that targets the protein CD152. This antibody has been developed as a biosimilar to the original anti-CD152 mAb, with the aim of providing researchers with a high-quality and cost-effective tool for studying the function of CD152 in various biological processes. In this article, we will discuss the structure, activity, and potential applications of Evalstotug Biosimilar in scientific research.

Structure of Evalstotug Biosimilar

Evalstotug Biosimilar is a recombinant monoclonal antibody that is produced in a laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains are approximately 150 kDa in size, while the light chains are about 25 kDa. The antibody has a Y-shaped structure, with two antigen-binding sites located at the tips of the arms.

The variable regions of the heavy and light chains are responsible for the specificity of Evalstotug Biosimilar towards CD152. These regions contain complementary determining regions (CDRs) that interact with specific amino acid sequences on the CD152 protein. The constant regions of the antibody, on the other hand, determine its effector functions, such as binding to immune cells and activating immune responses.

Activity of Evalstotug Biosimilar

The main activity of Evalstotug Biosimilar is its ability to bind to CD152. This protein, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), is a cell surface receptor that is expressed on various immune cells, including T cells and B cells. CD152 plays a crucial role in regulating immune responses by inhibiting the activation and proliferation of T cells.

By binding to CD152, Evalstotug Biosimilar blocks its inhibitory function and promotes the activation of T cells. This can lead to increased immune responses, which can be beneficial in certain disease conditions, such as cancer and autoimmune disorders. Additionally, this antibody can also bind to CD152 on regulatory T cells, which are important in maintaining immune tolerance. By blocking CD152 on these cells, Evalstotug Biosimilar can potentially modulate immune tolerance and promote anti-tumor responses.

Applications of Evalstotug Biosimilar

Evalstotug Biosimilar has a wide range of potential applications in scientific research. One of its main uses is in studying the role of CD152 in immune responses. By using this antibody, researchers can investigate the effects of blocking CD152 on various immune cells and its impact on immune function. This can provide valuable insights into the mechanisms of immune regulation and potential therapeutic targets for immune-related diseases.

Furthermore, Evalstotug Biosimilar can also be used in cancer research. As CD152 is overexpressed on many types of cancer cells, this antibody can be used to target and potentially kill these cells. Additionally, by blocking CD152 on regulatory T cells, Evalstotug Biosimilar can potentially enhance anti-tumor immune responses and improve the efficacy of cancer immunotherapy.

Other potential applications of Evalstotug Biosimilar include studying the role of CD152 in autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, and investigating the effects of CD152 blockade on transplant rejection in organ transplantation.

Conclusion

Evalstotug Biosimilar is a research grade monoclonal antibody that targets CD152, a protein involved in immune regulation. Its structure, activity, and potential applications make it a valuable tool for studying the role of CD152 in various biological processes. As a biosimilar, it offers a more affordable alternative to the original anti-CD152 mAb, making it accessible to a wider

Research Grade Evalstotug binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Evalstotug binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Evalstotug in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Evalstotug

SDS-PAGE for Research Grade Evalstotug

Research Grade Evalstotug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Evalstotug Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products