Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vipalanebart Biosimilar – Anti-Pituitary adenylate cyclase-activating polypeptide mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vipalanebart Biosimilar - Anti-Pituitary adenylate cyclase-activating polypeptide mAb - Research Grade

Product name PX-TA2150-50
Uniprot ID P18509
Source CAS: 2642173-04-2
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2150
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Vipalanebart Biosimilar - Anti-Pituitary adenylate cyclase-activating polypeptide mAb - Research Grade
Uniprot ID P18509
Source CAS: 2642173-04-2
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2150
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Vipalanebart Biosimilar - Anti-Pituitary adenylate cyclase-activating polypeptide mAb - Research Grade
Uniprot ID P18509
Source CAS: 2642173-04-2
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2150
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Vipalanebart Biosimilar – Anti-Pituitary adenylate cyclase-activating polypeptide mAb – Research Grade is a novel monoclonal antibody that targets the pituitary adenylate cyclase-activating polypeptide (PACAP) protein. This biosimilar is designed to mimic the structure and function of the original Vipalanebart antibody, which has shown promising results in preclinical studies for the treatment of various disorders. In this article, we will explore the structure, activity, and potential applications of Vipalanebart Biosimilar in detail.

Structure of Vipalanebart Biosimilar

Vipalanebart Biosimilar is a monoclonal antibody, which means it is a protein made by identical immune cells that are all clones of a unique parent cell. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains are approximately 50 kDa in size and consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains are approximately 25 kDa in size and consist of two constant domains (CL and CL2) and one variable domain (VL). The variable domains of both heavy and light chains are responsible for binding to the target antigen, PACAP.

Activity of Vipalanebart Biosimilar

Vipalanebart Biosimilar is specifically designed to target and bind to PACAP, a neuropeptide that plays a crucial role in various physiological processes such as neurotransmission, inflammation, and immune response. By binding to PACAP, Vipalanebart Biosimilar can block its activity and prevent it from exerting its effects. This can potentially lead to the suppression of PACAP-mediated processes, which may be beneficial in the treatment of certain diseases.

Applications of Vipalanebart Biosimilar

As a biosimilar of the original Vipalanebart antibody, Vipalanebart Biosimilar has the potential to be used in a variety of therapeutic applications. Some potential applications of this antibody include:

1. Treatment of migraine: PACAP has been implicated in the pathogenesis of migraine, and studies have shown that blocking PACAP activity can reduce the severity and frequency of migraine attacks. Vipalanebart Biosimilar, by targeting and inhibiting PACAP, may be a promising treatment option for migraine patients.

2. Treatment of inflammatory disorders: PACAP has been shown to have pro-inflammatory effects, and its levels are elevated in various inflammatory conditions such as rheumatoid arthritis and inflammatory bowel disease. By blocking PACAP, Vipalanebart Biosimilar may help alleviate the symptoms of these disorders.

3. Treatment of neurological disorders: PACAP is involved in the regulation of neuronal activity and has been linked to the development of neurological disorders such as Alzheimer’s disease and Parkinson’s disease. Vipalanebart Biosimilar may have the potential to slow down the progression of these disorders by targeting PACAP.

4. Treatment of autoimmune diseases: PACAP has been shown to play a role in the development of autoimmune diseases, and its levels are elevated in patients with conditions such as multiple sclerosis and type 1 diabetes. By inhibiting PACAP, Vipalanebart Biosimilar may help regulate the immune response and improve the symptoms of these diseases.

Conclusion

In conclusion, Vipalanebart Biosimilar – Anti-Pituitary adenylate cyclase-activating polypeptide mAb – Research Grade is a novel monoclonal antibody that targets PACAP and has the potential to be used in the treatment of various disorders. Its unique structure and mechanism of action make it a promising therapeutic option for conditions involving PACAP dysregulation. Further research and clinical trials are needed to fully evaluate the efficacy and safety of Vipalanebart Biosimilar in different disease settings.

SDS-PAGE for Research Grade Vipalanebart

SDS-PAGE for Research Grade Vipalanebart

Research Grade Vipalanebart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Vipalanebart Biosimilar - Anti-Pituitary adenylate cyclase-activating polypeptide mAb - Research Grade

There are no reviews yet.

Be the first to review “Vipalanebart Biosimilar – Anti-Pituitary adenylate cyclase-activating polypeptide mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products