Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Puxitatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $331.00.Current price is: $238.00.

100ug 28% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Puxitatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade

Product name Puxitatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade
Uniprot ID Q7Z7D3
Source CAS: 2760250-47-1
Species Human
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA1964
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Puxitatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade
Uniprot ID Q7Z7D3
Source CAS: 2760250-47-1
Species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA1964
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1964-50
Uniprot ID Q7Z7D3
Source CAS: 2760250-47-1
Species Human
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA1964
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction:

Puxitatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade, is a monoclonal antibody that has been developed as a biosimilar to the original Puxitatug antibody. This biosimilar is a highly specific and potent inhibitor of the V-set domain-containing T-cell activation inhibitor 1 (VISTA) protein, which is a key regulator of immune responses. In this article, we will explore the structure, activity, and potential applications of Puxitatug Biosimilar in the field of immunotherapy.

Structure:

Puxitatug Biosimilar is a recombinant humanized monoclonal antibody, composed of two heavy chains and two light chains. The heavy chains are made up of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of one constant domain (CL) and one variable domain (VL). The VH and VL domains together form the antigen-binding site, which is responsible for the specific recognition and binding of the VISTA protein.

Activity:

The VISTA protein is a checkpoint inhibitor that is expressed on the surface of immune cells, including T cells, B cells, and myeloid cells. Its main function is to suppress immune responses and maintain immune homeostasis. However, in certain diseases, such as cancer, VISTA is overexpressed and can contribute to immune evasion and tumor growth. Puxitatug Biosimilar works by binding to the VISTA protein and blocking its inhibitory function, thereby enhancing the activity of immune cells and promoting anti-tumor responses.

Application:

Puxitatug Biosimilar has shown promising results in preclinical studies as a potential therapeutic agent for various types of cancer, including melanoma, lung cancer, and breast cancer. It has also been investigated in combination with other immunotherapies, such as PD-1 inhibitors, and has shown synergistic effects in enhancing anti-tumor immune responses. In addition, Puxitatug Biosimilar has the potential to be used in the treatment of autoimmune diseases, where VISTA is upregulated and contributes to disease progression.

Benefits:

As a biosimilar, Puxitatug Biosimilar offers several advantages over the original Puxitatug antibody. Firstly, it is more cost-effective, making it more accessible to patients. Secondly, it has a similar structure and activity to the original antibody, ensuring similar efficacy and safety profiles. Thirdly, Puxitatug Biosimilar can be produced in larger quantities, allowing for wider distribution and potential use in combination therapies.

Clinical Development:

Puxitatug Biosimilar is currently in the preclinical stage of development, with plans for clinical trials in the near future. The aim of these trials is to evaluate the safety, efficacy, and pharmacokinetics of Puxitatug Biosimilar in patients with various types of cancer. If successful, Puxitatug Biosimilar has the potential to become a valuable addition to the current arsenal of immunotherapies for cancer treatment.

Conclusion:

In summary, Puxitatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade, is a promising biosimilar antibody that has the potential to enhance anti-tumor immune responses and improve outcomes for patients with cancer. Its specific binding to the VISTA protein makes it a valuable therapeutic option for various types of cancer and autoimmune diseases. With ongoing clinical development, Puxitatug Biosimilar has the potential to become an important tool in the field of immunotherapy.

SDS-PAGE for Research Grade Puxitatug

SDS-PAGE for Research Grade Puxitatug

Research Grade Puxitatug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Puxitatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Puxitatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products