Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD132 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P31785
Molecular weight:
30.70kDa

$380.00

100ug + 380 loyalty points
Met1–Asn254 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD132 Recombinant Protein

Product name CD132 Recombinant Protein
Uniprot ID P31785
Uniprot link http://www.uniprot.org/uniprot/P31785
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Molecular weight 30.70kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn254
Aliases /Synonyms IL2RG
Reference PX-P4105
Note For research use only
Background information Array
Molecular Constructor
Met1–Asn254 His

General information on CD132 Recombinant Protein:

The common gamma chain (γc) (or CD132), also known as the interleukin 2 receptor γ or IL2RG subunit, is a member of the type I cytokine family and is expressed in most lymphocytes (leukocytes) and its cells in mammals. A gene was found on its X chromosome. The common γ (γc) chain (or IL2RG) is the cytokine receptor subunit, which is the cytokine receptor subunit shared by the receptor complexes of at least six different interleukin receptors. IL-2, IL-4, IL-7, IL-9, IL-15 and interleukin 21 receptors. It is a component of many cytokine receptors, which are essential for the development and function of lymphocytes. Severe X-linked combined immunodeficiency (XSCID) is a rare and life-threatening disease caused by mutations in IL2RG (the gene that encodes IL2RG). Based on chemical binding data, IL2RG has been shown to be a component of the IL-4 receptor, that is, the ability of IL2RG to increase IL-4 binding affinity. The observation that the IL-2R range is a functional part of the IL-4 receptor, and the discovery that IL-2Rγ is related to the IL-7 receptor, began to explain why the lack of this γ chain common (γc) has an impact on lymphatic development and function. It has a profound impact, as seen in X-linked severe combined immunodeficiency.

There are no reviews yet.

Be the first to review “CD132 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products