Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD274 / PD-L1 / B7-H1, N-His, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9NZQ7
Molecular weight:
27.50 kDa

$392.00

100ug + 392 loyalty points
His Phe19–Arg238
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD274 / PD-L1 / B7-H1, N-His, recombinant protein

Product name CD274 / PD-L1 / B7-H1, N-His, recombinant protein
Uniprot ID Q9NZQ7
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Molecular weight 27.50 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe19-Arg238
Protein Accession Q9NZQ7
Reference PX-P5608
Note For research use only
Molecular Constructor
His Phe19–Arg238

General information on CD274 / PD-L1 / B7-H1, N-His, recombinant protein

Structure

CD274 / PD-L1 / B7-H1 is a type I transmembrane protein that is expressed on the surface of various cells, including antigen-presenting cells. It is composed of a single extracellular immunoglobulin-like domain, a transmembrane domain, and a short cytoplasmic tail.

Activity

CD274 / PD-L1 / B7-H1 is an inhibitory receptor that binds to its ligand, programmed cell death-1 (PD-1), expressed on the surface of activated T cells. This interaction suppresses T cell activation and proliferation, and promotes the induction of tolerance.

Application

CD274 / PD-L1 / B7-H1 is involved in the regulation of immune responses and is a target for immunotherapy. The use of monoclonal antibodies to block the interaction between CD274 / PD-L1 / B7-H1 and PD-1 has been shown to enhance anti-tumor immunity, leading to improved clinical outcomes in cancer patients.

SDS-PAGE for CD274 / PD-L1 / B7-H1, N-His, recombinant protein

SDS-PAGE for CD274 / PD-L1 / B7-H1, N-His, recombinant protein

CD274 / PD-L1 / B7-H1, N-His, recombinant protein on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %

CD274 / PD-L1 / B7-H1, N-His, recombinant protein

There are no reviews yet.

Be the first to review “CD274 / PD-L1 / B7-H1, N-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products