Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

CXCL11 / I-TAC, N-GST, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14625
Molecular weight:
35.14 kDa

$380.00

100ug + 380 loyalty points
GST Phe22–Phe94
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
CXCL11 / I-TAC, N-GST, recombinant protein

CXCL11 / I-TAC, N-GST, recombinant protein

Product name CXCL11 / I-TAC, N-GST, recombinant protein
Uniprot ID O14625
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Molecular weight 35.14 kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe22-Phe94
Protein Accession O14625
Reference PX-P5677
Note For research use only
Molecular Constructor
GST Phe22–Phe94

CXCL11 / I-TAC, N-GST, recombinant protein

There are no reviews yet.

Be the first to review “CXCL11 / I-TAC, N-GST, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products