Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein

Host species:
Insect
Origin species:
Dermatophagoides farinae (American house dust mite)
Uniprot ID:
A1YW12
Molecular weight:
51.58 kDa

$250.00

50ug + 250 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein

Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein

Product name Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein
Uniprot ID A1YW12
Uniprot link http://www.uniprot.org/uniprot/A1YW12
Origin species Dermatophagoides farinae (American house dust mite)
Expression system Eukaryotic expression
Sequence MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCASQHGCHGDTIPRGIE YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLM MIEQYPYVVIMGSHHHHHH
Molecular weight 51.58 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Full-length
NCBI Reference A1YW12
Aliases /Synonyms Der f 1 allergen(Derf1)
Reference PX-P3018
Note For research use only
Molecular Constructor
Full-length Yes
Product name Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein
Uniprot ID A1YW12
Uniprot link http://www.uniprot.org/uniprot/A1YW12
Origin species Dermatophagoides farinae (American house dust mite)
Expression system Eukaryotic expression
Sequence MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCASQHGCHGDTIPRGIE YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLM MIEQYPYVVIMGSHHHHHH
Molecular weight 51.58 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Full-length
NCBI Reference A1YW12
Aliases /Synonyms Der f 1 allergen(Derf1)
Reference PX-P3018
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products