Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

DNase1-Dockerine chimeric construct(DNASE1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P00639
Molecular weight:
41.4kDa

$217.00

50ug + 217 loyalty points
His Met1–Thr282
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

DNase1-Dockerine chimeric construct(DNASE1)

Product name DNase1-Dockerine chimeric construct(DNASE1)
Uniprot ID P00639
Uniprot link https://www.uniprot.org/uniprot/P00639
Expression system Prokaryotic expression
Raw Antigen Sequence MGKIWLALAGLVLAFSASAGSHHHHHHSGLKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDPNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSSHSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQWSSIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHYPVEVTLTGPGTKLVPTWGDTNCDGVVNVADVVVLNRFLNDPTYSNITDQGKVNADVVDPQDKSGAAVDPAGVKLTVADSEAILKAIVELITLPQ
Molecular weight 41.4kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr282
Protein Accession P00639
Spec:Entrez GeneID 282217
Spec:SwissProtID Q8MJ27
NCBI Reference P00639
Aliases /Synonyms DNase I, DNL1
Reference PX-P4877
Note For research use only
Molecular Constructor
His Met1–Thr282
Product name DNase1-Dockerine chimeric construct(DNASE1)
Uniprot ID P00639
Uniprot link https://www.uniprot.org/uniprot/P00639
Expression system Prokaryotic expression
Raw Antigen Sequence MGKIWLALAGLVLAFSASAGSHHHHHHSGLKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDPNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSSHSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQWSSIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHYPVEVTLTGPGTKLVPTWGDTNCDGVVNVADVVVLNRFLNDPTYSNITDQGKVNADVVDPQDKSGAAVDPAGVKLTVADSEAILKAIVELITLPQ
Molecular weight 41.4kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr282
Protein Accession P00639
Spec:Entrez GeneID 282217
Spec:SwissProtID Q8MJ27
NCBI Reference P00639
Aliases /Synonyms DNase I, DNL1
Reference PX-P4877
Note For research use only
Molecular Constructor
His Met1–Thr282

There are no reviews yet.

Be the first to review “DNase1-Dockerine chimeric construct(DNASE1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products