Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Duvakitug Biosimilar – Anti-TNFSF15 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Duvakitug Biosimilar - Anti-TNFSF15 mAb - Research Grade

Product name Duvakitug Biosimilar - Anti-TNFSF15 mAb - Research Grade
Uniprot ID O95150
Source CAS: 2750005-84-4
Species Human
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, TL1, TNF ligand-related molecule 1, Tumor necrosis factor ligand superfamily member 15
Reference PX-TA1942
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Duvakitug Biosimilar - Anti-TNFSF15 mAb - Research Grade
Uniprot ID O95150
Source CAS: 2750005-84-4
Species Human
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, TL1, TNF ligand-related molecule 1, Tumor necrosis factor ligand superfamily member 15
Reference PX-TA1942
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1942-50
Uniprot ID O95150
Source CAS: 2750005-84-4
Species Human
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, TL1, TNF ligand-related molecule 1, Tumor necrosis factor ligand superfamily member 15
Reference PX-TA1942
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Duvakitug Biosimilar is a novel therapeutic antibody that specifically targets the TNFSF15 protein. This biosimilar is a research-grade version of an existing anti-TNFSF15 monoclonal antibody, designed to mimic the structure and function of the original antibody. In this article, we will explore the structure, activity, and potential applications of Duvakitug Biosimilar in the field of biopharmaceutical research.

Structure of Duvakitug Biosimilar

Duvakitug Biosimilar is a recombinant monoclonal antibody, produced in a laboratory setting using advanced biotechnology techniques. It is a fully humanized antibody, meaning that it is derived from human cells and does not contain any non-human components. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains, connected by disulfide bonds.

The variable region of Duvakitug Biosimilar is designed to specifically bind to the TNFSF15 protein, a member of the tumor necrosis factor (TNF) superfamily. The constant region of the antibody is responsible for recruiting and activating immune cells to target and eliminate cells expressing TNFSF15. This unique structure allows Duvakitug Biosimilar to effectively block the activity of TNFSF15, which plays a crucial role in inflammatory and autoimmune diseases.

Activity of Duvakitug Biosimilar

The primary mechanism of action of Duvakitug Biosimilar is through its ability to bind and neutralize TNFSF15. This protein is known to play a role in various inflammatory and autoimmune diseases, including Crohn’s disease, ulcerative colitis, and rheumatoid arthritis. By blocking the activity of TNFSF15, Duvakitug Biosimilar can reduce inflammation and prevent tissue damage caused by excessive immune responses.

In addition to its neutralizing activity, Duvakitug Biosimilar also has the ability to trigger the immune system to eliminate cells expressing TNFSF15. This is achieved through the recruitment and activation of immune cells, such as natural killer cells and macrophages, which can directly kill target cells or induce cell death through the release of cytokines. This dual mechanism of action makes Duvakitug Biosimilar a potent therapeutic agent for diseases involving TNFSF15.

Applications of Duvakitug Biosimilar

Duvakitug Biosimilar has a wide range of potential applications in biopharmaceutical research. Its ability to target TNFSF15 makes it a promising candidate for the treatment of various inflammatory and autoimmune diseases, as well as certain types of cancer. In preclinical studies, Duvakitug Biosimilar has shown promising results in reducing disease severity and improving clinical outcomes in animal models of Crohn’s disease and rheumatoid arthritis.

Furthermore, Duvakitug Biosimilar can also be used as a research tool to study the role of TNFSF15 in different disease states and to develop new therapeutic strategies targeting this protein. Its high specificity and potency make it a valuable tool for understanding the complex mechanisms underlying inflammatory and autoimmune diseases.

Conclusion

In summary, Duvakitug Biosimilar is a novel research-grade antibody designed to target the TNFSF15 protein. Its unique structure and dual mechanism of action make it a promising therapeutic agent for the treatment of inflammatory and autoimmune diseases. Additionally, Duvakitug Biosimilar has potential applications as a research tool in the field of biopharmaceutical research. Further studies and clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar, but it holds great promise in improving the treatment options for patients with TNFSF15-mediated diseases.

SDS-PAGE for Research Grade Duvakitug

SDS-PAGE for Research Grade Duvakitug

Research Grade Duvakitug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Duvakitug Biosimilar - Anti-TNFSF15 mAb - Research Grade

There are no reviews yet.

Be the first to review “Duvakitug Biosimilar – Anti-TNFSF15 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products