Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efmitermant alfa Biosimilar – Anti-GDF-8 fusion protein – Research Grade

Uniprot ID:
O14793

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

Product name Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2039
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FST (follistatin)]2 - IGHG2 Fc (Fragment constant)
Product name Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2039
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FST (follistatin)]2 - IGHG2 Fc (Fragment constant)
Product name PX-TA2039-50
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2039
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FST (follistatin)]2 - IGHG2 Fc (Fragment constant)

Introduction

Efmitermant alfa is a biosimilar of the anti-GDF-8 fusion protein, which is a promising therapeutic target for a variety of diseases. This article will provide a scientific description of Efmitermant alfa, including its structure, activity, and potential applications.

Structure of Efmitermant alfa

Efmitermant alfa is a fusion protein that consists of two components: a monoclonal antibody and a growth differentiation factor 8 (GDF-8) receptor. The monoclonal antibody component is derived from a humanized antibody, which has been engineered to specifically bind to GDF-8. The GDF-8 receptor component is a modified version of the natural receptor, with enhanced binding affinity and stability.

The two components are linked together by a flexible linker, which allows for optimal binding and activity of the fusion protein. The overall structure of Efmitermant alfa is similar to that of other antibody-based drugs, with a Y-shaped structure and two antigen-binding sites.

Activity of Efmitermant alfa

Efmitermant alfa acts as a potent inhibitor of GDF-8, also known as myostatin. GDF-8 is a member of the transforming growth factor-beta (TGF-β) superfamily and is primarily produced in skeletal muscle cells. It plays a critical role in regulating muscle growth and development, and its overexpression has been linked to various muscle-related disorders, such as muscular dystrophy and cachexia.

By binding to GDF-8, Efmitermant alfa blocks its activity and prevents it from interacting with its natural receptor. This leads to a decrease in GDF-8 signaling and allows for increased muscle growth and repair. In addition, Efmitermant alfa has been shown to have anti-inflammatory effects, which may contribute to its therapeutic benefits in certain diseases.

Applications of Efmitermant alfa

Efmitermant alfa has shown promising results in preclinical studies for the treatment of various muscle-related disorders. These include muscular dystrophy, sarcopenia, and cachexia, as well as muscle wasting associated with chronic diseases such as cancer and HIV.

In a study on a mouse model of muscular dystrophy, Efmitermant alfa was able to improve muscle strength and function, as well as reduce muscle inflammation and fibrosis. In another study on a mouse model of cancer cachexia, treatment with Efmitermant alfa resulted in increased muscle mass and improved overall survival.

In addition to its potential therapeutic applications, Efmitermant alfa is also being used as a research tool to study the role of GDF-8 in various diseases and to identify potential new therapeutic targets. Its high specificity and potency make it a valuable tool for understanding the complex pathways involved in muscle growth and disease.

Conclusion

In summary, Efmitermant alfa is a promising biosimilar of the anti-GDF-8 fusion protein, with a unique structure and potent activity against GDF-8. Its potential applications in the treatment of various muscle-related disorders make it a valuable addition to the arsenal of therapeutic options. Furthermore, its use as a research tool may lead to a better understanding of the role of GDF-8 in disease and the development of new treatments.

SDS-PAGE for Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

SDS-PAGE for Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Efmitermant alfa Biosimilar – Anti-GDF-8 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products