Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Trebananib Biosimilar – Anti-ANG-2 fusion protein – Research Grade

Uniprot ID:
O15123

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade

Product name Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade
Uniprot ID O15123
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-ANG-2, ANGPT2, Angiopoietin-2
Reference PX-TA2036
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IGHG1 Fc (Fragment constant) - [peptide 14-mer - peptide 14-mer]2]
Product name Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade
Uniprot ID O15123
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-ANG-2, ANGPT2, Angiopoietin-2
Reference PX-TA2036
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IGHG1 Fc (Fragment constant) - [peptide 14-mer - peptide 14-mer]2]
Product name PX-TA2036-50
Uniprot ID O15123
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-ANG-2, ANGPT2, Angiopoietin-2
Reference PX-TA2036
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IGHG1 Fc (Fragment constant) - [peptide 14-mer - peptide 14-mer]2]

Introduction

Trebananib Biosimilar, also known as Anti-ANG-2 fusion protein, is a research grade antibody that has shown promising results in the treatment of various diseases. This fusion protein has been designed to target and inhibit the activity of angiopoietin-2 (ANG-2), a protein that plays a crucial role in promoting blood vessel growth. In this article, we will explore the structure, activity, and potential applications of Trebananib Biosimilar in the field of biomedicine.

Structure of Trebananib Biosimilar

Trebananib Biosimilar is a fusion protein that is composed of two different components – a humanized monoclonal antibody and the extracellular domain of the ANG-2 receptor. The monoclonal antibody is designed to specifically bind to ANG-2, while the receptor domain acts as a decoy to neutralize the activity of ANG-2. This structure allows Trebananib Biosimilar to effectively block the interaction between ANG-2 and its receptor, thereby inhibiting the pro-angiogenic effects of ANG-2.

Activity of Trebananib Biosimilar

Trebananib Biosimilar works by targeting and inhibiting the activity of ANG-2, a protein that is involved in the regulation of blood vessel growth. ANG-2 is known to promote the formation of new blood vessels, a process called angiogenesis, which is essential for tissue growth and repair. However, in certain diseases such as cancer, ANG-2 can become overactive and promote abnormal blood vessel growth, leading to tumor growth and metastasis.

By binding to ANG-2 and blocking its interaction with its receptor, Trebananib Biosimilar effectively inhibits angiogenesis and prevents the formation of new blood vessels. This not only limits the supply of nutrients and oxygen to the tumor, but also disrupts its ability to spread to other parts of the body. In addition, Trebananib Biosimilar has been shown to enhance the activity of certain chemotherapeutic agents, making it a potential combination therapy for cancer treatment.

Applications of Trebananib Biosimilar

Trebananib Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various diseases, particularly cancer. In a phase III clinical trial, Trebananib Biosimilar was evaluated as a treatment for ovarian cancer and showed significant improvement in progression-free survival when used in combination with chemotherapy. This suggests that Trebananib Biosimilar has the potential to be a valuable addition to the current treatment options for ovarian cancer.

In addition to cancer, Trebananib Biosimilar has also shown potential in the treatment of other diseases such as diabetic retinopathy and age-related macular degeneration. These diseases are characterized by abnormal blood vessel growth in the eye, which can lead to vision loss. By inhibiting angiogenesis, Trebananib Biosimilar has the potential to prevent or slow down the progression of these diseases.

Conclusion

Trebananib Biosimilar, also known as Anti-ANG-2 fusion protein, is a research grade antibody that has shown promising results in the treatment of various diseases. Its unique structure allows it to effectively target and inhibit the activity of ANG-2, a protein involved in promoting blood vessel growth. With its potential applications in cancer and other diseases, Trebananib Biosimilar holds great promise as a therapeutic agent in the field of biomedicine. Further research and clinical trials are needed to fully explore its potential and bring this promising treatment to patients in need.

SDS-PAGE for Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade

SDS-PAGE for Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade

Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Trebananib Biosimilar – Anti-ANG-2 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products