Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Endoplasmin(HSP90B1)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P14625
Molecular weight:
32.62 kDa

$169.00

100ug + 169 loyalty points
His Asp22–Ala311
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Endoplasmin(HSP90B1)

Endoplasmin(HSP90B1)

Product name Endoplasmin(HSP90B1)
Uniprot ID P14625
Uniprot link https://www.uniprot.org/uniprot/P14625
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence DDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSL YKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGT IAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPR GNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDE AA
Molecular weight 32.62 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Ala311
Protein Accession P14625
Spec:Entrez GeneID 7184
Spec:NCBI Gene Aliases ECGP; GP96; TRA1; GRP94; HEL35; HEL-S-125m
Spec:SwissProtID Q96A97
NCBI Reference P14625
Aliases /Synonyms 94 kDa glucose-regulated protein,GRP-94,Heat shock protein 90 kDa beta member 1,Tumor rejection antigen 1,gp96 homolog,GRP94, TRA1
Reference PX-P4788
Note For research use only
Molecular Constructor
His Asp22–Ala311
Product name Endoplasmin(HSP90B1)
Uniprot ID P14625
Uniprot link https://www.uniprot.org/uniprot/P14625
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence DDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSL YKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGT IAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPR GNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDE AA
Molecular weight 32.62 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Ala311
Protein Accession P14625
Spec:Entrez GeneID 7184
Spec:NCBI Gene Aliases ECGP; GP96; TRA1; GRP94; HEL35; HEL-S-125m
Spec:SwissProtID Q96A97
NCBI Reference P14625
Aliases /Synonyms 94 kDa glucose-regulated protein,GRP-94,Heat shock protein 90 kDa beta member 1,Tumor rejection antigen 1,gp96 homolog,GRP94, TRA1
Reference PX-P4788
Note For research use only
Molecular Constructor
His Asp22–Ala311

There are no reviews yet.

Be the first to review “Endoplasmin(HSP90B1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products