Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

FSH protein – Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein

Host species:
Mammalian cells
Origin species:
Chinese sturgeon
Uniprot ID:
B2CKR3
Molecular weight:
39.85 kDa

Original price was: $263.00.Current price is: $202.00.

20ug 23% OFF + 202 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein

Product name FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein
Uniprot ID B2CKR3
Uniprot link http://www.uniprot.org/uniprot/B2CKR3
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MASVLFCFVLLCWAAGQCHASCALENITIGIEKDGCGNCVSVNTTSCAGRCLTQADVYKSSISLYTQLVCTFKEISYVTVQLPNCPEHVDPFYTYPVALSCECGQCATDYTDCGTLSLGPSDCFSQEDDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 39.85 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR3
Aliases /Synonyms Follicle Stimulating Hormone, FSH
Reference PX-P3016
Note For research use only
Molecular Constructor
Full-length Yes
Product name FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein
Uniprot ID B2CKR3
Uniprot link http://www.uniprot.org/uniprot/B2CKR3
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MASVLFCFVLLCWAAGQCHASCALENITIGIEKDGCGNCVSVNTTSCAGRCLTQADVYKSSISLYTQLVCTFKEISYVTVQLPNCPEHVDPFYTYPVALSCECGQCATDYTDCGTLSLGPSDCFSQEDDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 39.85 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR3
Aliases /Synonyms Follicle Stimulating Hormone, FSH
Reference PX-P3016
Note For research use only
Molecular Constructor
Full-length Yes
Product name FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein
Uniprot ID B2CKR3
Uniprot link http://www.uniprot.org/uniprot/B2CKR3
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MASVLFCFVLLCWAAGQCHASCALENITIGIEKDGCGNCVSVNTTSCAGRCLTQADVYKSSISLYTQLVCTFKEISYVTVQLPNCPEHVDPFYTYPVALSCECGQCATDYTDCGTLSLGPSDCFSQEDDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 39.85 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR3
Aliases /Synonyms Follicle Stimulating Hormone, FSH
Reference PX-P3016
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P3016-1MG
Uniprot ID B2CKR3
Uniprot link http://www.uniprot.org/uniprot/B2CKR3
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MASVLFCFVLLCWAAGQCHASCALENITIGIEKDGCGNCVSVNTTSCAGRCLTQADVYKSSISLYTQLVCTFKEISYVTVQLPNCPEHVDPFYTYPVALSCECGQCATDYTDCGTLSLGPSDCFSQEDDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 39.85 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR3
Aliases /Synonyms Follicle Stimulating Hormone, FSH
Reference PX-P3016
Note For research use only
Molecular Constructor
Full-length Yes

FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein

There are no reviews yet.

Be the first to review “FSH protein – Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products