Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Mannose-binding protein C

Host species:
Mammalian cells
Uniprot ID:
P08661
Molecular weight:
27.27kDa

$250.00

+ 250 loyalty points
Glu19–Asp244 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mannose-binding protein C

Mannose-binding protein C

Product name Mannose-binding protein C
Uniprot ID P08661
Uniprot link https://www.uniprot.org/uniprot/P08661
Expression system Eukaryotic expression
Sequence MKHLWFFLLLVAAPRWVLSETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSDGSHHHHHH
Molecular weight 27.27kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu19-Asp244
Protein Accession P08661
Spec:Entrez GeneID 64668
Spec:NCBI Gene Aliases Ab2-001; Ab2-011
NCBI Reference P08661
Aliases /Synonyms Mbl2
Reference PX-P4455
Note For research use only
Molecular Constructor
Glu19–Asp244 His
Product name Mannose-binding protein C
Uniprot ID P08661
Uniprot link https://www.uniprot.org/uniprot/P08661
Expression system Eukaryotic expression
Sequence MKHLWFFLLLVAAPRWVLSETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSDGSHHHHHH
Molecular weight 27.27kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu19-Asp244
Protein Accession P08661
Spec:Entrez GeneID 64668
Spec:NCBI Gene Aliases Ab2-001; Ab2-011
NCBI Reference P08661
Aliases /Synonyms Mbl2
Reference PX-P4455
Note For research use only
Molecular Constructor
Glu19–Asp244 His

There are no reviews yet.

Be the first to review “Mannose-binding protein C”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products