Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ACVR2B recombinant protein

  • PX-P6106
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q13705
Molecular weight:
41.57 kDa

$225.00

100ug + 225 loyalty points
Met1–Thr134 Fc
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ACVR2B recombinant protein

Product name Human ACVR2B recombinant protein
Uniprot ID Q13705
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
Molecular weight 41.57 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr134
Aliases /Synonyms ACTR-IIB, Activin receptor type IIB, Activin receptor type-2B, ACVR2B, Drug Target
Reference PX-P6106
Note For research use only
Molecular Constructor
Met1–Thr134 Fc

Bimagrumab Biosimilar - Anti-ACVR2A, ACVR2B mAb - Research Grade binds to ACVR2B in indirect ELISA Assay

Bimagrumab Biosimilar - Anti-ACVR2A, ACVR2B mAb - Research Grade binds to ACVR2B in indirect ELISA Assay

Immobilized ACVR2B (cat. No.PX-P6106) at 2µg/mL (100µL/well) can bind to Bimagrumab Biosimilar - Anti-ACVR2A, ACVR2B mAb - Research Grade (cat. No.PX-TA1315) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human ACVR2B recombinant protein

There are no reviews yet.

Be the first to review “Human ACVR2B recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products