Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD137–TNFRSF9-4–1BB recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q07011
Molecular weight:
20.8kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD137--TNFRSF9-4--1BB recombinant protein

Human CD137--TNFRSF9-4--1BB recombinant protein

Product name Human CD137--TNFRSF9-4--1BB recombinant protein
Uniprot ID Q07011
Uniprot link http://www.uniprot.org/uniprot/Q07011
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQGSHHHHHH
Molecular weight 20.8kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD137, CDw137, 4-1BB, ILA, Induced By Lymphocyte Activation, T-cell antigen 4-1BB homolog, Tumor necrosis factor receptor superfamily member 9
Reference PX-P4059
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD137--TNFRSF9-4--1BB recombinant protein
Uniprot ID Q07011
Uniprot link http://www.uniprot.org/uniprot/Q07011
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQGSHHHHHH
Molecular weight 20.8kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD137, CDw137, 4-1BB, ILA, Induced By Lymphocyte Activation, T-cell antigen 4-1BB homolog, Tumor necrosis factor receptor superfamily member 9
Reference PX-P4059
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human CD137–TNFRSF9-4–1BB recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products