Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD14 (28C5) Monoclonal Antibody

  • ARO-A16034-50
  • Validated WB

Original price was: $444.00.Current price is: $326.00.

50ug 27% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD14 (28C5) Monoclonal Antibody

Product name ARO-A16034-100
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16034
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (28C5)
Clone Name 28C5
Protein Name CD14 (28C5)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16034-1MG
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16034
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (28C5)
Clone Name 28C5
Protein Name CD14 (28C5)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16034-50
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16034
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (28C5)
Clone Name 28C5
Protein Name CD14 (28C5)
Target species Anti-Human Monoclonal Antibody

Human CD14 (28C5) Monoclonal Antibody binds to Human CD14 recombinant protein in WB Assay

Human CD14 (28C5) Monoclonal Antibody binds to Human CD14 recombinant protein in WB Assay

Human CD14 recombinant protein(cat. No.PX-P6553) can bind Human CD14 (28C5) Monoclonal Antibody in Western Blot Assay as detected on gel analysis.

Human CD14 (28C5) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD14 (28C5) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products