Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD14 (F1024D-D1D2) Monoclonal Antibody

  • ARO-A16038-50
  • Validated ELISA

Original price was: $418.00.Current price is: $326.00.

50ug 22% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD14 (F1024D-D1D2) Monoclonal Antibody

Product name ARO-A16038-100
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16038
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (F1024D-D1D2)
Clone Name F1024D-D1D2
Protein Name CD14 (F1024D-D1D2)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16038-1MG
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16038
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (F1024D-D1D2)
Clone Name F1024D-D1D2
Protein Name CD14 (F1024D-D1D2)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16038-50
Uniprot ID P08571
Uniprot link P08571
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14
Reference ARO-A16038
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD14 (F1024D-D1D2)
Clone Name F1024D-D1D2
Protein Name CD14 (F1024D-D1D2)
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD14 (F1024D-D1D2) Monoclonal Antibody

SEC-HPLC of Human CD14 (F1024D-D1D2) Monoclonal Antibody

Human CD14 (F1024D-D1D2) Monoclonal Antibody(ARO-A16176) was analyzed by size exclusion chromatography with UV detection.

Human CD14 (F1024D-D1D2) Monoclonal Antibody binds to Human CD14 recombinant protein in ELISA Assay

Human CD14 (F1024D-D1D2) Monoclonal Antibody binds to Human CD14 recombinant protein in ELISA Assay

Human CD14 recombinant protein(cat. No.PX-P6553) at 0.5µg/mL (100µL/well) can bind Human CD14 (F1024D-D1D2) Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

Human CD14 (F1024D-D1D2) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD14 (F1024D-D1D2) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products