Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD159a-KLRC1 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P26715
Molecular weight:
43.86 kDa

$500.00

100ug + 500 loyalty points
Fc Pro94–Leu233
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD159a-KLRC1 recombinant protein

Product name Human CD159a-KLRC1 recombinant protein
Uniprot ID P26715
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence PSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
Molecular weight 43.86 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro94-Leu233
Aliases /Synonyms KLRC1, NKG2-A/NKG2-B type II integral membrane protein, NKG2-A/B-activating NK receptor, CD159 antigen-like family member A, CD159a, NK cell receptor A, NKG2A, Drug Target
Reference PX-P6098
Note For research use only
Molecular Constructor
Fc Pro94–Leu233

Human CD159a-KLRC1 recombinant protein

There are no reviews yet.

Be the first to review “Human CD159a-KLRC1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products