Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD207 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9UJ71
Molecular weight:
57.40 kDa

$500.00

100ug + 500 loyalty points
Fc Pro65–Pro328
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD207 recombinant protein

Product name Human CD207 recombinant protein
Uniprot ID Q9UJ71
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence PRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Molecular weight 57.40 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro65-Pro328
Aliases /Synonyms C-type lectin domain family 4 member K, CLEC4K, Langerin, CD207
Reference PX-P6232
Note For research use only
Molecular Constructor
Fc Pro65–Pro328

Human CD207 recombinant protein

There are no reviews yet.

Be the first to review “Human CD207 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products