Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD307e/FCRL5 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q96RD9

Original price was: $468.00.Current price is: $387.00.

100ug 17% OFF + 387 loyalty points
Val745–Arg844 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD307e/FCRL5 Recombinant Protein, C-His

Human CD307e/FCRL5 Recombinant Protein, C-His

Product name ARO-P17845-100
Uniprot ID Q96RD9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence VAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANR
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val745-Arg844
Aliases /Synonyms Fc receptor-like protein 5, FcR-like protein 5, FcRL5, BXMAS1, Fc receptor homolog 5, FcRH5, Immune receptor translocation-associated protein 2, CD307e, FCRL5, FCRH5, IRTA2, UNQ503/PRO820
Reference ARO-P17845
Note For research use only.
Molecular Constructor
Val745–Arg844 His
Product name ARO-P17845-1MG
Uniprot ID Q96RD9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence VAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANR
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val745-Arg844
Aliases /Synonyms Fc receptor-like protein 5, FcR-like protein 5, FcRL5, BXMAS1, Fc receptor homolog 5, FcRH5, Immune receptor translocation-associated protein 2, CD307e, FCRL5, FCRH5, IRTA2, UNQ503/PRO820
Reference ARO-P17845
Note For research use only.
Molecular Constructor
Val745–Arg844 His
Product name ARO-P17845-50
Uniprot ID Q96RD9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence VAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANR
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val745-Arg844
Aliases /Synonyms Fc receptor-like protein 5, FcR-like protein 5, FcRL5, BXMAS1, Fc receptor homolog 5, FcRH5, Immune receptor translocation-associated protein 2, CD307e, FCRL5, FCRH5, IRTA2, UNQ503/PRO820
Reference ARO-P17845
Note For research use only.
Molecular Constructor
Val745–Arg844 His

There are no reviews yet.

Be the first to review “Human CD307e/FCRL5 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products