Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD292/BMPR1A Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P36894

Original price was: $437.00.Current price is: $387.00.

100ug 11% OFF + 387 loyalty points
Met1–Arg152 Fc
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human CD292/BMPR1A Recombinant Protein, C-Fc

Human CD292/BMPR1A Recombinant Protein, C-Fc

Product name ARO-P18121-100
Uniprot ID P36894
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg152
Aliases /Synonyms Bone morphogenetic protein receptor type-1A, BMP type-1A receptor, BMPR-1A, EC:2.7.11.30, Activin receptor-like kinase 3, ALK-3, Serine/threonine-protein kinase receptor R5, SKR5, CD292, BMPR1A, ACVRLK3, ALK3
Reference ARO-P18121
Note For research use only.
Molecular Constructor
Met1–Arg152 Fc
Product name ARO-P18121-1MG
Uniprot ID P36894
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg152
Aliases /Synonyms Bone morphogenetic protein receptor type-1A, BMP type-1A receptor, BMPR-1A, EC:2.7.11.30, Activin receptor-like kinase 3, ALK-3, Serine/threonine-protein kinase receptor R5, SKR5, CD292, BMPR1A, ACVRLK3, ALK3
Reference ARO-P18121
Note For research use only.
Molecular Constructor
Met1–Arg152 Fc
Product name ARO-P18121-50
Uniprot ID P36894
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg152
Aliases /Synonyms Bone morphogenetic protein receptor type-1A, BMP type-1A receptor, BMPR-1A, EC:2.7.11.30, Activin receptor-like kinase 3, ALK-3, Serine/threonine-protein kinase receptor R5, SKR5, CD292, BMPR1A, ACVRLK3, ALK3
Reference ARO-P18121
Note For research use only.
Molecular Constructor
Met1–Arg152 Fc

SDS-PAGE for Human CD292/BMPR1A Recombinant Protein, C-Fc

SDS-PAGE for Human CD292/BMPR1A Recombinant Protein, C-Fc

Human CD292/BMPR1A Recombinant Protein, C-Fc, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Human CD292/BMPR1A Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products