Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CD292/BMPR1A Polyclonal Antibody

  • ARO-A12747-100
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $268.00.Current price is: $201.00.

100ug 25% OFF + 201 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human CD292/BMPR1A Polyclonal Antibody binds to Human CD292/BMPR1A Recombinant Protein, C-Fc in WB Assay

Anti-Human CD292/BMPR1A Polyclonal Antibody

Product name ARO-A12747-100
Uniprot ID P36894
Raw Antigen Sequence YCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCI
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ACVRLK3, Bone morphogenetic protein receptor type-1A, ALK3, BMPR-1A, Serine/threonine-protein kinase receptor R5, SKR5, Activin receptor-like kinase 3, ALK-3, BMP type-1A receptor, BMPR1A, CD292
Reference ARO-A12747
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human CD292/BMPR1A (Tyr179-Ile378).
Product name ARO-A12747-1MG
Uniprot ID P36894
Raw Antigen Sequence YCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCI
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ACVRLK3, Bone morphogenetic protein receptor type-1A, ALK3, BMPR-1A, Serine/threonine-protein kinase receptor R5, SKR5, Activin receptor-like kinase 3, ALK-3, BMP type-1A receptor, BMPR1A, CD292
Reference ARO-A12747
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human CD292/BMPR1A (Tyr179-Ile378).
Product name ARO-A12747-50
Uniprot ID P36894
Raw Antigen Sequence YCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCI
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ACVRLK3, Bone morphogenetic protein receptor type-1A, ALK3, BMPR-1A, Serine/threonine-protein kinase receptor R5, SKR5, Activin receptor-like kinase 3, ALK-3, BMP type-1A receptor, BMPR1A, CD292
Reference ARO-A12747
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human CD292/BMPR1A (Tyr179-Ile378).

Anti-Human CD292/BMPR1A Polyclonal Antibody binds to Human CD292/BMPR1A Recombinant Protein, C-Fc in WB Assay

Anti-Human CD292/BMPR1A Polyclonal Antibody binds to Human CD292/BMPR1A Recombinant Protein, C-Fc in WB Assay

Human CD292/BMPR1A Recombinant Protein, C-Fc(cat. No.ARO-P18121) can bind Anti-Human CD292/BMPR1A Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human CD292/BMPR1A Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products