Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human CD292/BMPR1A Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P36894
Molecular weight:
34.95 kDa

Original price was: $505.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Tyr179–Ile378
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human CD292/BMPR1A Protein, N-His-SUMO

Recombinant Human CD292/BMPR1A Protein, N-His-SUMO

Product name ARO-P10339-100
Uniprot ID P36894
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCI
Molecular weight 34.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr179-Ile378
Aliases /Synonyms ACVRLK3, Bone morphogenetic protein receptor type-1A, ALK3, BMPR-1A, Serine/threonine-protein kinase receptor R5, SKR5, Activin receptor-like kinase 3, ALK-3, BMP type-1A receptor, BMPR1A, CD292
Reference ARO-P10339
Note For research use only.
Molecular Constructor
Tyr179–Ile378
Product name ARO-P10339-1MG
Uniprot ID P36894
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCI
Molecular weight 34.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr179-Ile378
Aliases /Synonyms ACVRLK3, Bone morphogenetic protein receptor type-1A, ALK3, BMPR-1A, Serine/threonine-protein kinase receptor R5, SKR5, Activin receptor-like kinase 3, ALK-3, BMP type-1A receptor, BMPR1A, CD292
Reference ARO-P10339
Note For research use only.
Molecular Constructor
Tyr179–Ile378
Product name ARO-P10339-50
Uniprot ID P36894
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCI
Molecular weight 34.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr179-Ile378
Aliases /Synonyms ACVRLK3, Bone morphogenetic protein receptor type-1A, ALK3, BMPR-1A, Serine/threonine-protein kinase receptor R5, SKR5, Activin receptor-like kinase 3, ALK-3, BMP type-1A receptor, BMPR1A, CD292
Reference ARO-P10339
Note For research use only.
Molecular Constructor
Tyr179–Ile378

Recombinant Human CD292/BMPR1A Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CD292/BMPR1A Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products