Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD74 (LL1) Monoclonal Antibody

  • ARO-A15793-50
  • Validated ELISA

Original price was: $157.00.Current price is: $130.00.

50ug 17% OFF + 130 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SEC-HPLC of Human CD74 (LL1) Monoclonal Antibody
Human CD74 (LL1) Monoclonal Antibody

Human CD74 (LL1) Monoclonal Antibody

Product name ARO-A15793-100
Uniprot ID P04233
Uniprot link P04233
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms HLA-DR antigens-associated invariant chain, HLA class II histocompatibility antigen gamma chain, CD74, CLIP, Ia antigen-associated invariant chain, DHLAG, Ii
Reference ARO-A15793
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD74 (LL1)
Clone Name LL1
Protein Name CD74 (LL1)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15793-1MG
Uniprot ID P04233
Uniprot link P04233
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms HLA-DR antigens-associated invariant chain, HLA class II histocompatibility antigen gamma chain, CD74, CLIP, Ia antigen-associated invariant chain, DHLAG, Ii
Reference ARO-A15793
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD74 (LL1)
Clone Name LL1
Protein Name CD74 (LL1)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15793-50
Uniprot ID P04233
Uniprot link P04233
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms HLA-DR antigens-associated invariant chain, HLA class II histocompatibility antigen gamma chain, CD74, CLIP, Ia antigen-associated invariant chain, DHLAG, Ii
Reference ARO-A15793
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD74 (LL1)
Clone Name LL1
Protein Name CD74 (LL1)
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD74 (LL1) Monoclonal Antibody

SEC-HPLC of Human CD74 (LL1) Monoclonal Antibody

Human CD74 (LL1) Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD74 (LL1) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD74 (LL1) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products