Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD79β/CD79B Monoclonal Antibody

  • ARO-A15756-50
  • Validated FC

Original price was: $365.00.Current price is: $275.00.

50ug 25% OFF + 275 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody
Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody
Human CD79β/CD79B Monoclonal Antibody

Human CD79β/CD79B Monoclonal Antibody

Product name ARO-A15756-100
Uniprot ID P40259
Uniprot link P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b
Reference ARO-A15756
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79β/CD79B
Clone Name SAA0036
Protein Name CD79β/CD79B
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15756-1MG
Uniprot ID P40259
Uniprot link P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b
Reference ARO-A15756
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79β/CD79B
Clone Name SAA0036
Protein Name CD79β/CD79B
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15756-50
Uniprot ID P40259
Uniprot link P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b
Reference ARO-A15756
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79β/CD79B
Clone Name SAA0036
Protein Name CD79β/CD79B
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody

Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody

Flow-cytometry using anti-human CD79β antibody.Human peripheral blood lymphocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD79β antibody monoclonal antibody (Catalog # ARO-A15756 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody

Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody

Flow-cytometry using anti-human CD79β antibody.Daudi cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD79β antibody monoclonal antibody (Catalog # ARO-A15756 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Human CD79β/CD79B Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD79β/CD79B Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products