Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD85f/LILRA5 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
A6NI73
Molecular weight:
53.58 kDa

Original price was: $352.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
Gly42–Arg268 Fc
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD85f/LILRA5 Recombinant Protein, C-Fc

Human CD85f/LILRA5 Recombinant Protein, C-Fc

Product name ARO-P20635-100
Uniprot ID A6NI73
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Molecular weight 53.58 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly42-Arg268
Aliases /Synonyms CD85 antigen-like family member F, CD85f, ILT-11, ILT11, Immunoglobulin-like transcript 11, LILRA5, LILRB7, LIR-9, LIR9, Leukocyte immunoglobulin-like receptor 9, Leukocyte immunoglobulin-like receptor subfamily A member 5
Reference ARO-P20635
Note For research use only.
Molecular Constructor
Gly42–Arg268 Fc
Product name ARO-P20635-1MG
Uniprot ID A6NI73
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Molecular weight 53.58 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly42-Arg268
Aliases /Synonyms CD85 antigen-like family member F, CD85f, ILT-11, ILT11, Immunoglobulin-like transcript 11, LILRA5, LILRB7, LIR-9, LIR9, Leukocyte immunoglobulin-like receptor 9, Leukocyte immunoglobulin-like receptor subfamily A member 5
Reference ARO-P20635
Note For research use only.
Molecular Constructor
Gly42–Arg268 Fc
Product name ARO-P20635-50
Uniprot ID A6NI73
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Molecular weight 53.58 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly42-Arg268
Aliases /Synonyms CD85 antigen-like family member F, CD85f, ILT-11, ILT11, Immunoglobulin-like transcript 11, LILRA5, LILRB7, LIR-9, LIR9, Leukocyte immunoglobulin-like receptor 9, Leukocyte immunoglobulin-like receptor subfamily A member 5
Reference ARO-P20635
Note For research use only.
Molecular Constructor
Gly42–Arg268 Fc

There are no reviews yet.

Be the first to review “Human CD85f/LILRA5 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products