Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-CD85f/LILRA5 Polyclonal Antibody

  • PTX20634-50
  • Validated WB

Original price was: $171.00.Current price is: $140.00.

50ug 18% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human CD85f/LILRA5 Polyclonal Antibody binds to Human CD85f/LILRA5 Recombinant Protein, C-Fc in WB Assay

Anti-CD85f/LILRA5 Polyclonal Antibody

Product name PTX20634-100
Uniprot ID A6NI73
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-LIR-9, CD85f, LILRA5, ILT11, LILRB7, LIR9, Leukocyte immunoglobulin-like receptor subfamily A member 5, CD85 antigen-like family member F, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD85f/LILRA5
Format Liquid
Product name PTX20634-1MG
Uniprot ID A6NI73
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-LIR-9, CD85f, LILRA5, ILT11, LILRB7, LIR9, Leukocyte immunoglobulin-like receptor subfamily A member 5, CD85 antigen-like family member F, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD85f/LILRA5
Format Liquid
Product name PTX20634-50
Uniprot ID A6NI73
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-LIR-9, CD85f, LILRA5, ILT11, LILRB7, LIR9, Leukocyte immunoglobulin-like receptor subfamily A member 5, CD85 antigen-like family member F, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD85f/LILRA5
Format Liquid

Anti-Human CD85f/LILRA5 Polyclonal Antibody binds to Human CD85f/LILRA5 Recombinant Protein, C-Fc in WB Assay

Anti-Human CD85f/LILRA5 Polyclonal Antibody binds to Human CD85f/LILRA5 Recombinant Protein, C-Fc in WB Assay

Human CD85f/LILRA5 Recombinant Protein, C-Fc(cat. No.ARO-P20635) can bind Anti-Human CD85f/LILRA5 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-CD85f/LILRA5 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products