Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD85f-LILRA5 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
A6NI73
Molecular weight:
28.15 kDa

$451.00

100ug + 451 loyalty points
Gly42–Arg268 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD85f-LILRA5 recombinant protein

Product name Human CD85f-LILRA5 recombinant protein
Uniprot ID A6NI73
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Molecular weight 28.15 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly42-Arg268
Aliases /Synonyms Leukocyte immunoglobulin-like receptor subfamily A member 5, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9, LIR9, CD85f, LIR-9, LILRB7, CD85 antigen-like family member F, LILRA5, ILT11
Reference PX-P6148
Note For research use only
Molecular Constructor
Gly42–Arg268 His

Human CD85f-LILRA5 recombinant protein

There are no reviews yet.

Be the first to review “Human CD85f-LILRA5 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products