Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD9 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P21926
Molecular weight:
12.58 kDa

Original price was: $363.00.Current price is: $330.00.

50ug 9% OFF + 330 loyalty points
Ser112–Ile195 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD9 recombinant protein

Human CD9 recombinant protein

Product name PX-P6424-100
Uniprot ID P21926
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 12.58 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser112-Ile195
Aliases /Synonyms 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein, MRP-1, Tetraspanin-29, Tspan-29, p24, CD9, CD9, MIC3, TSPAN29, GIG2CD9 antigen,
Reference PX-P6424
Molecular Constructor
Ser112–Ile195 His
Product name PX-P6424-1MG
Uniprot ID P21926
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 12.58 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser112-Ile195
Aliases /Synonyms 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein, MRP-1, Tetraspanin-29, Tspan-29, p24, CD9, CD9, MIC3, TSPAN29, GIG2CD9 antigen,
Reference PX-P6424
Molecular Constructor
Ser112–Ile195 His
Product name PX-P6424-50
Uniprot ID P21926
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 12.58 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser112-Ile195
Aliases /Synonyms 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein, MRP-1, Tetraspanin-29, Tspan-29, p24, CD9, CD9, MIC3, TSPAN29, GIG2CD9 antigen,
Reference PX-P6424
Molecular Constructor
Ser112–Ile195 His

Human CD9 recombinant protein

There are no reviews yet.

Be the first to review “Human CD9 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products