Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ChromograninA Partial (19-260) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P10645
Molecular weight:
50.26 kDa

$250.00

50ug + 250 loyalty points
Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ChromograninA Partial (19-260) Recombinant Protein

Product name Human ChromograninA Partial (19-260) Recombinant Protein
Uniprot ID P10645
Uniprot link http://www.uniprot.org/uniprot/P10645
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSL
Molecular weight 50.26 kDa
Protein delivered with Tag? Yes
Purity estimated #N/A
Buffer Tris-HC 50mMl, pH 7.5, NaCl 150mM
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:NCBI Gene Aliases CGA
Spec:SwissProtID P10645
Aliases /Synonyms ChromograninA Partial [19-260], chromogranin A (parathyroid secretory protein 1), Chromogranin-A, CgA, Pituitary secretory protein I, SP-I
Reference PX-P2103
Note For research use only
Molecular Constructor
Yes
Product name Human ChromograninA Partial (19-260) Recombinant Protein
Uniprot ID P10645
Uniprot link http://www.uniprot.org/uniprot/P10645
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSL
Molecular weight 50.26 kDa
Protein delivered with Tag? Yes
Purity estimated #N/A
Buffer Tris-HC 50mMl, pH 7.5, NaCl 150mM
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:NCBI Gene Aliases CGA
Spec:SwissProtID P10645
Aliases /Synonyms ChromograninA Partial [19-260], chromogranin A (parathyroid secretory protein 1), Chromogranin-A, CgA, Pituitary secretory protein I, SP-I
Reference PX-P2103
Note For research use only
Molecular Constructor
Yes

There are no reviews yet.

Be the first to review “Human ChromograninA Partial (19-260) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products