Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FGF9 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P31371
Molecular weight:
50.97 kDa

$451.00

100ug + 451 loyalty points
Fc Leu4–Ser208
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FGF9 recombinant protein

Product name Human FGF9 recombinant protein
Uniprot ID P31371
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Molecular weight 50.97 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu4-Ser208
Aliases /Synonyms FGF9, Glia-activating factor, GAF, Heparin-binding Growth Factor proteins 9, FGF-9, Fibroblast Growth Factor proteins 9, HBGF-9
Reference PX-P6145
Note For research use only
Molecular Constructor
Fc Leu4–Ser208

Human FGF9 recombinant protein

There are no reviews yet.

Be the first to review “Human FGF9 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products