Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human FUT3 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P21217

Original price was: $472.00.Current price is: $387.00.

100ug 18% OFF + 387 loyalty points
Arg35–Thr361 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human FUT3 Recombinant Protein, C-His

Human FUT3 Recombinant Protein, C-His

Product name ARO-P17783-100
Uniprot ID P21217
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence RVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLRTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADMVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg35-Thr361
Aliases /Synonyms 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3, EC:2.4.1.65, 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase, EC:2.4.1.152, Alpha-3-fucosyltransferase FUT3, 2.4.1.-, Blood group Lewis alpha-4-fucosyltransferase, Lewis FT, Fucosyltransferase 3, Fucosyltransferase III, FucT-III, FUT3
Reference ARO-P17783
Note For research use only.
Molecular Constructor
Arg35–Thr361 His
Product name ARO-P17783-1MG
Uniprot ID P21217
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence RVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLRTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADMVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg35-Thr361
Aliases /Synonyms 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3, EC:2.4.1.65, 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase, EC:2.4.1.152, Alpha-3-fucosyltransferase FUT3, 2.4.1.-, Blood group Lewis alpha-4-fucosyltransferase, Lewis FT, Fucosyltransferase 3, Fucosyltransferase III, FucT-III, FUT3
Reference ARO-P17783
Note For research use only.
Molecular Constructor
Arg35–Thr361 His
Product name ARO-P17783-50
Uniprot ID P21217
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence RVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLRTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADMVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg35-Thr361
Aliases /Synonyms 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3, EC:2.4.1.65, 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase, EC:2.4.1.152, Alpha-3-fucosyltransferase FUT3, 2.4.1.-, Blood group Lewis alpha-4-fucosyltransferase, Lewis FT, Fucosyltransferase 3, Fucosyltransferase III, FucT-III, FUT3
Reference ARO-P17783
Note For research use only.
Molecular Constructor
Arg35–Thr361 His

There are no reviews yet.

Be the first to review “Human FUT3 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products