Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human GFRAL recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q6UXV0
Molecular weight:
40.70 kDa

Original price was: $330.00.Current price is: $265.00.

50ug 20% OFF + 265 loyalty points
Ser19–Glu351 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human GFRAL recombinant protein

Human GFRAL recombinant protein

Product name PX-P6442-100
Uniprot ID Q6UXV0
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
Molecular weight 40.70 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser19-Glu351
Aliases /Synonyms GFRAL, C6orf144, UNQ9356/PRO34128GDNF family receptor alpha-like,
Reference PX-P6442
Molecular Constructor
Ser19–Glu351 His
Product name PX-P6442-1MG
Uniprot ID Q6UXV0
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
Molecular weight 40.70 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser19-Glu351
Aliases /Synonyms GFRAL, C6orf144, UNQ9356/PRO34128GDNF family receptor alpha-like,
Reference PX-P6442
Molecular Constructor
Ser19–Glu351 His
Product name PX-P6442-50
Uniprot ID Q6UXV0
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
Molecular weight 40.70 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser19-Glu351
Aliases /Synonyms GFRAL, C6orf144, UNQ9356/PRO34128GDNF family receptor alpha-like,
Reference PX-P6442
Molecular Constructor
Ser19–Glu351 His

Human GFRAL recombinant protein

There are no reviews yet.

Be the first to review “Human GFRAL recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products